PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00292
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 411aa    MW: 45456.9 Da    PI: 4.7667
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00292genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.51.1e-16223279359
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                 ++kr rr+ +NRe+ArrsR+RK++++ eLe+ v eL++e ++L k+l++++ ++++ 
  AA32G00292 223 DVKRSRRMLSNRESARRSRRRKQEQTSELETQVGELKGEHSTLLKQLSNMNHKYDEA 279
                 78******************************************9999999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000413.3E-5103125IPR001630cAMP response element binding (CREB) protein
PRINTSPR000413.3E-5220236IPR001630cAMP response element binding (CREB) protein
SMARTSM003382.9E-19221285IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.312223278IPR004827Basic-leucine zipper domain
PfamPF001701.3E-14223277IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-11224276No hitNo description
Gene3DG3DSA:1.20.5.1705.8E-13225276No hitNo description
PROSITE patternPS000360228243IPR004827Basic-leucine zipper domain
PRINTSPR000413.3E-5238258IPR001630cAMP response element binding (CREB) protein
PRINTSPR000413.3E-5258275IPR001630cAMP response element binding (CREB) protein
PfamPF124982.4E-13292343IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MNSVFSIDDF SDPFWEQPPP LNSDSEKVVT VDEISQSQPE WTFEMFLEEI SSSVSSEPVG  60
NNAIIGVSSA QSCLSVSGQN DIDDDASRFY SRGRRDNDRD SGNWDSAPRQ TVLGDSDDYH  120
RVLKSKLETE CITAAVSLRS GSVKPEDSTS SPETQFHPVQ TSPSPQGSLM APRELGVSSS  180
LPAEVKKSGV PMKQVTSGSS REDSDDDDLD EENETTGSLN PEDVKRSRRM LSNRESARRS  240
RRRKQEQTSE LETQVGELKG EHSTLLKQLS NMNHKYDEAA VDNRILKADI ETLRAKVKMA  300
EETVKRVTGM NPLLLGRSNG HNTRMPLTGN RITSSCIPAF PNHLSNQQVP NIPIPNILEN  360
DFTSNTLVPP LPSLNRHVSP TTNPYNNAWS TESSPHTVPQ NDSAWSKKCV D
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1237244RRSRRRKQ
2239244SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849290.11e-178basic leucine zipper 10
SwissprotO227631e-174BZP10_ARATH; Basic leucine zipper 10
TrEMBLD7M3F71e-175D7M3F7_ARALL; Putative uncharacterized protein
STRINGAT4G02640.21e-177(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148711720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.21e-162bZIP family protein